PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold08235-abinit-gene-0.0-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family SRS
Protein Properties Length: 207aa    MW: 23210.2 Da    PI: 8.9472
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold08235-abinit-gene-0.0-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702179.11.9e-5581433154
                                                DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaa 59 
                                                           +gt++CqdCGnqakk+C+++RCRtCCk++gf+C+thvkstW+p ++rr+rqq+++++
  augustus_masked-scaffold08235-abinit-gene-0.0-mRNA-1   8 MGTSRCQDCGNQAKKECVYMRCRTCCKNKGFQCETHVKSTWIPLYRRRQRQQHQQQQ 64 
                                                           6899**********************************************8877664 PP

                                                DUF702  60 sska.aasaaeaaskrkrelkskkqsalsstklssaeskkeletsslPeevsseavf 115
                                                            +    ++ + +++kr+r               +s    + +e +++P+ev+s+a f
  augustus_masked-scaffold08235-abinit-gene-0.0-mRNA-1  65 LAAVlPQELQGHSPKRHRPI-------------HS----SGSEEAKFPAEVQSMATF 104
                                                           33320222233333333322.............22....2345678*********** PP

                                                DUF702 116 rcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                                                           rc+rvss+dd+++e+a+qtav+igGhvf+G+LydqGle+
  augustus_masked-scaffold08235-abinit-gene-0.0-mRNA-1 105 RCIRVSSMDDADDEYAFQTAVTIGGHVFRGVLYDQGLES 143
                                                           ************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.8E-5610142IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016234.6E-271354IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.9E-2593141IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MRQQGGLMGT SRCQDCGNQA KKECVYMRCR TCCKNKGFQC ETHVKSTWIP LYRRRQRQQH  60
QQQQLAAVLP QELQGHSPKR HRPIHSSGSE EAKFPAEVQS MATFRCIRVS SMDDADDEYA  120
FQTAVTIGGH VFRGVLYDQG LESRHTSTVG ESSSSRAHQQ PNNLLNAATL ATLTSDSAST  180
EPFLPPSYPF SLNAFMPGMQ FLPRPKT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313022.22e-74hypothetical protein POPTR_0009s12450g, partial
SwissprotQ9SD403e-56SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLB9HRI12e-74B9HRI1_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0009s12450.15e-74(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99692541
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21400.19e-48SHI-related sequence3